3.28 Rating by CuteStat

It is a domain having club extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, pi4anhhi.club is SAFE to browse.

PageSpeed Score
97
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

104.28.23.33

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 2
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 104.28.23.33)

Paul Irish

- paulirish.com
310,632 $ 28,620.00


سهامداران پدیده شاندیز و پدیده کیش

- shandizstocks.ir

سایت سهامداران پدیده شاندیز و پدیده کیش به همراه آخرین اخبار درباره پروژه های شرکت پدیده شاندیز محلی مناسب برای تمام افرای که سهام پدیده شاندیز را دارند

30,640 $ 271,440.00

uevf.org: SAG Awards 2020 Film Nominations: From 'Bombshell' to 'Paras

- uevf.org

Get the Latest News, updates, publications and the newest posts from sources uevf.org. SAG Awards 2020 Film Nominations: From 'Bombshell' to 'Parasite,' These Are the Ones to Beat

Not Applicable $ 8.95

Traffic Ticket Attorneys | York & Lancaster, PA | 717 889 7100

- centralpennsylvaniatrafficlawyers.com

Fight That Traffic Ticket! Whether it is a Speeding Ticket or another violation our experienced traffic lawyers will protect your right to drive and right to work

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Thu, 15 Jun 2017 16:01:18 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
X-Turbo-Charged-By: LiteSpeed
Server: cloudflare-nginx
CF-RAY: 36f6bf4703840cfb-ATL
Content-Encoding: gzip

Domain Nameserver Information

Host IP Address Country
apollo.ns.cloudflare.com 108.162.193.66 United States of America United States of America
vida.ns.cloudflare.com 108.162.192.236 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
pi4anhhi.club A 299 IP: 104.28.22.33
pi4anhhi.club A 299 IP: 104.28.23.33
pi4anhhi.club NS 86399 Target: apollo.ns.cloudflare.com
pi4anhhi.club NS 86399 Target: vida.ns.cloudflare.com
pi4anhhi.club SOA 3599 MNAME: apollo.ns.cloudflare.com
RNAME: dns.cloudflare.com
Serial: 2024892578
Refresh: 10000
Retry: 2400
Expire: 604800
Minimum TTL: 3600
pi4anhhi.club AAAA 291 IPV6: 2400:cb00:2048:1::681c:1721
pi4anhhi.club AAAA 291 IPV6: 2400:cb00:2048:1::681c:1621

Full WHOIS Lookup

Number of allowed queries exceeded.