Web Analysis for Pi4anhhi - pi4anhhi.club
3.28
Rating by CuteStat
It is a domain having club extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, pi4anhhi.club is SAFE to browse.
PageSpeed Score
97
Siteadvisor Rating
No Risk Issues
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | No Risk Issues |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 2 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 104.28.23.33)
Instagramers.com | Web for instagram addicts | Tips Apps iPhone Hipsta
- instagramers.com
1,023,359
$
1,200.00
سهامداران پدیده شاندیز و پدیده کیش
- shandizstocks.ir
سایت سهامداران پدیده شاندیز و پدیده کیش به همراه آخرین اخبار درباره پروژه های شرکت پدیده شاندیز محلی مناسب برای تمام افرای که سهام پدیده شاندیز را دارند
30,640
$
271,440.00
uevf.org: SAG Awards 2020 Film Nominations: From 'Bombshell' to 'Paras
- uevf.org
Get the Latest News, updates, publications and the newest posts from sources uevf.org. SAG Awards 2020 Film Nominations: From 'Bombshell' to 'Parasite,' These Are the Ones to Beat
Not Applicable
$
8.95
Traffic Ticket Attorneys | York & Lancaster, PA | 717 889 7100
- centralpennsylvaniatrafficlawyers.com
Fight That Traffic Ticket! Whether it is a Speeding Ticket or another violation our experienced traffic lawyers will protect your right to drive and right to work
Not Applicable
$
8.95
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Thu, 15 Jun 2017 16:01:18 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
X-Turbo-Charged-By: LiteSpeed
Server: cloudflare-nginx
CF-RAY: 36f6bf4703840cfb-ATL
Content-Encoding: gzip
Date: Thu, 15 Jun 2017 16:01:18 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
X-Turbo-Charged-By: LiteSpeed
Server: cloudflare-nginx
CF-RAY: 36f6bf4703840cfb-ATL
Content-Encoding: gzip
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
apollo.ns.cloudflare.com | 108.162.193.66 | United States of America | |
vida.ns.cloudflare.com | 108.162.192.236 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
pi4anhhi.club | A | 299 |
IP: 104.28.22.33 |
pi4anhhi.club | A | 299 |
IP: 104.28.23.33 |
pi4anhhi.club | NS | 86399 |
Target: apollo.ns.cloudflare.com |
pi4anhhi.club | NS | 86399 |
Target: vida.ns.cloudflare.com |
pi4anhhi.club | SOA | 3599 |
MNAME: apollo.ns.cloudflare.com RNAME: dns.cloudflare.com Serial: 2024892578 Refresh: 10000 Retry: 2400 Expire: 604800 Minimum TTL: 3600 |
pi4anhhi.club | AAAA | 291 |
IPV6: 2400:cb00:2048:1::681c:1721 |
pi4anhhi.club | AAAA | 291 |
IPV6: 2400:cb00:2048:1::681c:1621 |
Full WHOIS Lookup
Number of allowed queries exceeded.